The short version of HGF/c-Met fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-10-01. Anything still debated is marked as such rather than presented as settled.
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
The proposed mechanism of dihexa involves activation of hepatocyte growth factor and its receptor, c-Met. In cell models, this signaling pathway is associated with dendritic spine formation and synaptic reorganization. Dihexa is described as a stabilized analog of angiotensin IV, which also interacts with related systems. However, the precise binding profile and downstream effects remain incompletely characterized. Most mechanistic evidence comes from in vitro assays and rodent studies rather than human trials.
Research on dihexa has primarily used rodent models and cultured cells. Common endpoints include dendritic spine density, synaptic protein expression, and performance on maze or avoidance tasks. Some studies report improvements in cognitive measures after scopolamine-induced deficits or in aged animals. These findings are interesting but come from a small body of work, and independent laboratories have not consistently replicated all reported effects. Larger, preregistered studies would help clarify which results are robust.
Human data for dihexa remain absent from peer-reviewed clinical literature. As a result, questions about absorption, distribution, metabolism, excretion, and long-term safety are unresolved. Discussions often appear in nootropic forums, where anecdotal reports cannot substitute for controlled trials. Researchers have called for more rigorous pharmacokinetic and toxicological studies before any clinical evaluation. Until such data exist, dihexa is best described as an investigational research compound rather than a proven intervention.
| Property | Value | Notes |
|---|---|---|
| Primary reported target | Hepatocyte growth factor/c-Met signaling | Findings mainly from cell and animal studies. |
| Related endogenous peptide | Angiotensin IV | Dihexa is described as a stabilized analog. |
| Common analytical method | Reverse-phase high-performance liquid chromatography | Used for purity assessment. |
| Identity confirmation | Mass spectrometry | Provides a molecular mass check. |
| Regulatory status | Not approved for human use | Sold as a research chemical in many jurisdictions. |
The proposed mechanism of dihexa centers on activation of the hepatocyte growth factor receptor, also called c-Met. Some studies suggest it acts as a mimetic of hepatocyte growth factor, promoting signaling pathways involved in synapse formation. Other work has explored interactions with angiotensin IV pathways, but the exact binding targets remain uncertain. Laboratory findings come mainly from cell cultures and animal models. Whether these mechanisms operate similarly in humans is an open question. Researchers have not established a single, universally accepted mechanism of action.
Identity and purity of dihexa samples are typically assessed with high-performance liquid chromatography and mass spectrometry. These methods can confirm molecular mass and estimate the presence of impurities. However, a certificate of analysis from a supplier is not a guarantee of independent testing. Researchers often require in-house verification before using a peptide in experiments. For solid samples, appearance, solubility, and chromatographic profile provide additional checks. Nuclear magnetic resonance may be used for structural confirmation when available.
Animal studies have examined dihexa in models of cognitive impairment, synaptic plasticity, and memory. Some reports describe improved performance on maze or avoidance tasks after administration. These findings are preclinical and often involve small samples, varied routes, and differing formulations. Results in rodents do not establish effects in humans. The absence of published randomized controlled trials in people is a major gap in the evidence base. Observational reports and user accounts do not substitute for controlled clinical data.
Discussion in the literature often separates direct receptor activation from downstream growth-factor modulation. Dihexa is not simply an angiotensin receptor blocker or a classic nootropic drug. Its proposed action may depend on endogenous HGF levels, which vary by tissue and physiological state. Questions remain about brain penetration, metabolic stability, and active metabolites. Reviews note that mechanistic claims should be treated as hypotheses until supported by independent studies. That distinction is important when interpreting promotional claims or early laboratory findings.
The leading hypothesis for dihexa centers on hepatocyte growth factor (HGF) and its receptor, c-Met. In cell-based assays, dihexa has been reported to potentiate HGF-dependent signaling. That pathway influences cell growth, survival, and motility. Because c-Met signaling is widespread, the proposed mechanism is broad rather than specific to neurons. The exact binding site and stoichiometry remain areas of active investigation, and independent replication is limited. This uncertainty limits firm conclusions about how the compound acts in living organisms.
Dihexa occupies an uncertain regulatory space in many countries. It is not generally listed as an approved therapeutic, and some jurisdictions may treat it as a research chemical, a compounded substance, or an unapproved new drug depending on claims and distribution. Importation can be restricted, and suppliers may require documentation that the material is for laboratory research only. Quality and labeling vary, so buyers should request analytical data, verify lot numbers, and understand local rules. These factors make sourcing and compliance part of the practical context around dihexa.
Lyophilized dihexa is typically stored as a dry powder at or below minus twenty degrees Celsius. Cooler temperatures slow degradation, and desiccant protection limits moisture uptake. Repeated temperature cycling can accelerate breakdown, so aliquoting before storage is common in laboratory practice. Solutions are generally less stable than dry powder and are often kept cold, protected from light, and used within a defined period. Specific stability data for dihexa are limited, and handling recommendations often follow general peptide guidelines rather than compound-specific studies.
Identity and purity are usually assessed with reverse-phase high-performance liquid chromatography and mass spectrometry. These methods can separate related impurities and confirm molecular mass, but they do not by themselves establish biological activity. Certificate of analysis documents may report purity as a percentage by area, yet the exact meaning can vary between laboratories. Independent testing can check for residual solvents, counterions, or microbial contamination when relevant. For research use, matching analytical records to a specific lot helps trace experimental variability.
Storage recommendations for peptides and peptide-like compounds usually emphasize low temperatures, desiccation, and protection from light. A common practice is to keep dry powder at -20 °C or below and to prepare solutions shortly before use. Repeated freeze-thaw cycles may degrade the material, so aliquoting is often advised. Solubility depends on the solvent; aqueous solubility may be limited, and organic solvents such as dimethyl sulfoxide are sometimes used for stock solutions. Stability data specific to dihexa are sparse, so general peptide handling guidelines are often applied instead.
Analytical confirmation generally combines a separation method with a detection method. Reverse-phase high-performance liquid chromatography can assess purity, while mass spectrometry supports molecular identity. For research-grade material, a certificate of analysis may report a batch-specific purity value, but it does not guarantee biological activity or safety. Regulatory frameworks vary by country; many jurisdictions treat dihexa as a research chemical not intended for human consumption. Purchasers should verify local rules and supplier documentation. The absence of official standards makes independent testing and careful record-keeping important for laboratory work.
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
The use of high-resolution ion-mobility mass spectrometry (IMS-MS) on HPLC-purified alpha-synuclein in vitro has shown alpha-synuclein to be autoproteolytic (self-proteolytic), generating a variety of small molecular weight fragments upon incubation. The 14.46 kDa protein was found to generate numerous smaller fragments, including 12.16 kDa (amino acids 14–133) and 10.44 kDa (40–140) fragments formed through C- and N-terminal truncation and a 7.27 kDa C-terminal fragment (72–140). The 7.27 kDa fragment, which contains the majority of the NAC region, aggregated considerably faster than full-length alpha-synuclein. It is possible that these autoproteolytic products play a role as intermediates or cofactors in the aggregation of alpha-synuclein in vivo.
Sources: en.wikipedia.org
The Department works at the intersection of organic chemistry (chemistry of natural products, chemistry of macrocyclic compounds, chemistry of elementorganic compounds), supramolecular chemistry (solution and self-process chemistry) and molecular biology. The head of the Department is Professor Igor S. Antipin, a corresponding member of the Russian Academy of Science, Doctor of Chemistry. The Department conducts research in the following fields:
PABA is an intermediate in the synthesis of folate by bacteria, plants, and fungi. Many bacteria, including those found in the human intestinal tract such as E. coli, generate PABA from chorismate by the combined action of the enzymes 4-amino-4-deoxychorismate synthase and 4-amino-4-deoxychorismate lyase. Plants produce PABA in their chloroplasts, and store it as a glucose ester (pABA-Glc) in their tissues. The malarial protozoan Plasmodium only make PABA when necessary, preferring to get it from the surroundings if able to. Some bacteria, including a few found in the human microbiome, are unable to make PABA for themselves but can use PABA to make folate. A few are very efficient at the PABA-to-folate conversion despite not making their own PABA. Sulfonamide drugs are structurally similar to PABA, and their antibacterial activity is due to their ability to interfere with the conversion of PABA to folate by the enzyme dihydropteroate synthetase. Thus, bacterial growth is limited through folate deficiency.
On the other hand, loss of control of cell death (resulting in excess apoptosis) can lead to neurodegenerative diseases, hematologic diseases, and tissue damage. Neurons that rely on mitochondrial respiration undergo apoptosis in neurodegenerative diseases such as Alzheimer's and Parkinson's. (an observation known as the "Inverse Warburg hypothesis"). Moreover, there is an inverse epidemiological comorbidity between neurodegenerative diseases and cancer. The progression of HIV is directly linked to excess, unregulated apoptosis. In a healthy individual, the number of CD4+ lymphocytes is in balance with the cells generated by the bone marrow; however, in HIV-positive patients, this balance is lost due to an inability of the bone marrow to regenerate CD4+ cells. In the case of HIV, CD4+ lymphocytes die at an accelerated rate through uncontrolled apoptosis, when stimulated. At the molecular level, hyperactive apoptosis can be caused by defects in signaling pathways that regulate the Bcl-2 family proteins. Increased expression of apoptotic proteins such as BIM, or their decreased proteolysis, leads to cell death and can cause a number of pathologies, depending on the cells where excessive activity of BIM occurs. Cancer cells can escape apoptosis through mechanisms that suppress BIM expression or by increased proteolysis of BIM.
Sources: en.wikipedia.org
Arrestins are elongated molecules, in which several intra-molecular interactions hold the relative orientation of the two domains. Unstimulated cell arrestins are localized in the cytoplasm in a basal inactive conformation. Active phosphorylated GPCRs recruit arrestin to the plasma membrane. Receptor binding induces a global conformational change that involves the movement of the two arrestin domains and the release of its C-terminal tail that contains clathrin and AP2 binding sites. Increased accessibility of these sites in receptor-bound arrestin targets the arrestin-receptor complex to the coated pit. Arrestins also bind microtubules (part of the cellular skeleton), where they assume yet another conformation, different from both free and receptor-bound form. Microtubule-bound arrestins recruit certain proteins to the cytoskeleton, which affects their activity and/or redirects it to microtubule-associated proteins. Arrestins shuttle between cell nucleus and cytoplasm. Their nuclear functions are not fully understood, but it was shown that all four mammalian arrestin subtypes remove some of their partners, such as protein kinase JNK3 or the ubiquitin ligase Mdm2, from the nucleus. Arrestins also modify gene expression by enhancing transcription of certain genes.
Although the mechanism by which Hmd acts is unknown, the iron-containing cofactor is in part responsible for the catalytic activity. High concentrations of CO inhibit the enzyme as well, implicating iron as the center of catalysis. It has been proposed that the iron functions to bind H2 and the substrate methenyltetrahydromethanopterin, organizing these two reactants in close proximity.
Isoforms I, III, and VIII are also stimulated by Ca2+/calmodulin. Isoforms V and VI are inhibited by Ca2+ in a calmodulin-independent manner. Isoforms II, IV and IX are stimulated by alpha subunit of the G protein. Isoforms I, V and VI are most clearly inhibited by Gi, while other isoforms show less dual regulation by the inhibitory G protein. Soluble AC (sAC) is not a transmembrane form and is not regulated by G proteins or forskolin, instead acts as a bicarbonate/pH sensor. It is anchored at various locations within the cell and, with phosphodiesterases, forms local cAMP signalling domains. In neurons, calcium-sensitive adenylyl cyclases are located next to calcium ion channels for faster reaction to Ca2+ influx; they are suspected of playing an important role in learning processes. This is supported by the fact that adenylyl cyclases are coincidence detectors, meaning that they are activated only by several different signals occurring together. In peripheral cells and tissues adenylyl cyclases appear to form molecular complexes with specific receptors and other signaling proteins in an isoform-specific manner.
Akt resides in the cytosol in an inactive conformation, until the cell is stimulated and it translocates to the plasma membrane. The Akt PH domain has a high affinity for second messenger PI(3,4,5)P3, binding to it preferentially over other phosphoinositides. Thus PI3K activity is essential for translocation of Akt to the membrane. Interaction with PI(3,4,5)P3 causes conformational changes and exposure of phosphorylation sites Thr308 in the kinase domain and Ser473 in the C-terminal domain. Akt is partially activated by phosphorylation of T308 by PDK1. Full activation requires phosphorylation of S473, which can be catalysed by multiple proteins, including phosphoinositide-dependent kinase 2 (PDK2), integrin-linked kinase (ILK), mechanistic target of rapamycin complex complex 2 (mTORC2) and DNA-dependent protein kinase (DNA-PK). The regulation of Ser473 phosphorylation is not fully understood but may also be influenced by autophosphorylation after Thr308 phosphorylation. After stimulation, the levels of PIP3 decrease and Akt activity is attenuated by dephosphorylation by serine/threonine phosphatases.
Sources: en.wikipedia.org
Dihexa has been reported to activate hepatocyte growth factor/c-Met signaling in cell studies. This pathway is linked to synapse formation and neuronal remodeling. The exact molecular interactions are not fully understood.
Reverse-phase high-performance liquid chromatography is commonly used to assess purity. Mass spectrometry is used to confirm molecular identity. These methods are typical for synthetic peptides and research chemicals.
Dihexa is not approved as a drug in major jurisdictions. It is often sold as a research chemical, which is not the same as a medicine. Its legal status can vary by country and may change.
Dihexa has been proposed to act through HGF and c-Met signaling. This pathway is linked to synapse formation and cellular growth. Direct binding and the precise molecular step remain uncertain.