The short version of HGF/c-Met fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-29. Anything still debated is marked as such rather than presented as settled.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
Identity checks for dihexa usually rely on mass spectrometry and chromatographic purity analysis. A lyophilized powder is the common supplied form, and it may appear as a white to off-white solid. Aqueous solubility is limited, so laboratory work often uses an organic solvent such as dimethyl sulfoxide to prepare stock solutions. Because the peptide is not a standard pharmaceutical product, exact specifications can vary between suppliers. Certificates of analysis may accompany a batch, but they are not equivalent to regulatory approval.
Dihexa is typically supplied as a lyophilized powder for laboratory research. Lyophilization removes water and improves stability during transport and storage. The solid is commonly stored at -20 °C or lower, desiccated, and protected from light. Repeated freeze-thaw cycles and exposure to moisture can degrade peptides, so aliquoting and sealed containers are standard practice in most laboratory settings. These handling measures apply to research-grade material and do not imply clinical suitability.
Purity and identity are usually assessed with reverse-phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry. RP-HPLC separates components by hydrophobicity and can estimate peptide purity. Mass spectrometry confirms molecular mass and helps detect truncations or modifications. Some laboratories also use amino acid analysis or nuclear magnetic resonance for structural verification. A certificate of analysis from a supplier may list these results, but independent verification is often recommended for critical work.
Regulatory status varies by country, and dihexa is not widely approved as a medicine. In many jurisdictions it is treated as a research chemical, which limits its legal sale, possession, and human use. Products marketed online may lack verified purity or identity, and labels can be inaccurate. Researchers typically source material from suppliers that provide analytical documentation and follow institutional safety rules. Open questions remain about long-term stability, metabolite formation, and human pharmacokinetics.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic peptide analog | Modeled on angiotensin IV; not a natural hormone. |
| Common synonyms | Dihexa; N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide | Naming conventions differ across vendors and papers. |
| CAS Registry Number | 1401708-83-6 | Listed in some chemical databases; verify against primary sources. |
| Appearance | White to off-white powder | Typical form for lyophilized research peptides. |
| Solubility | Soluble in DMSO; limited in water | Organic stock solutions are common in laboratory settings. |
Storage recommendations for peptides and peptide-like compounds usually emphasize low temperatures, desiccation, and protection from light. A common practice is to keep dry powder at -20 °C or below and to prepare solutions shortly before use. Repeated freeze-thaw cycles may degrade the material, so aliquoting is often advised. Solubility depends on the solvent; aqueous solubility may be limited, and organic solvents such as dimethyl sulfoxide are sometimes used for stock solutions. Stability data specific to dihexa are sparse, so general peptide handling guidelines are often applied instead.
Analytical confirmation generally combines a separation method with a detection method. Reverse-phase high-performance liquid chromatography can assess purity, while mass spectrometry supports molecular identity. For research-grade material, a certificate of analysis may report a batch-specific purity value, but it does not guarantee biological activity or safety. Regulatory frameworks vary by country; many jurisdictions treat dihexa as a research chemical not intended for human consumption. Purchasers should verify local rules and supplier documentation. The absence of official standards makes independent testing and careful record-keeping important for laboratory work.
In laboratory settings, dihexa is typically handled as a research chemical rather than a pharmaceutical product. Suppliers may provide it as a lyophilized powder or in solution, and purity is often stated as a percentage determined by chromatographic analysis. Because independent verification is uncommon, researchers generally rely on certificates of analysis, which may include high-performance liquid chromatography and mass spectrometry data. The absence of pharmacopeial monographs means that identity, purity, and impurity profiles can vary between batches and suppliers.
The leading hypothesis for dihexa centers on hepatocyte growth factor (HGF) and its receptor, c-Met. In cell-based assays, dihexa has been reported to potentiate HGF-dependent signaling. That pathway influences cell growth, survival, and motility. Because c-Met signaling is widespread, the proposed mechanism is broad rather than specific to neurons. The exact binding site and stoichiometry remain areas of active investigation, and independent replication is limited. This uncertainty limits firm conclusions about how the compound acts in living organisms.
Animal studies have examined dihexa in models of cognitive impairment, synaptic plasticity, and memory. Some reports describe improved performance on maze or avoidance tasks after administration. These findings are preclinical and often involve small samples, varied routes, and differing formulations. Results in rodents do not establish effects in humans. The absence of published randomized controlled trials in people is a major gap in the evidence base. Observational reports and user accounts do not substitute for controlled clinical data.
Discussion in the literature often separates direct receptor activation from downstream growth-factor modulation. Dihexa is not simply an angiotensin receptor blocker or a classic nootropic drug. Its proposed action may depend on endogenous HGF levels, which vary by tissue and physiological state. Questions remain about brain penetration, metabolic stability, and active metabolites. Reviews note that mechanistic claims should be treated as hypotheses until supported by independent studies. That distinction is important when interpreting promotional claims or early laboratory findings.
5-Oxo-ETE contracts smooth muscle and organ-cultured bronchi isolated from guinea pigs but relaxes bronchi isolated from human lung; the relaxation of human bronchi caused by 5-oxo-ETE may not involve its OXER1. These results suggest that 5-oxo-ETE is not directly involved in the bronchoconstriction) that occurs in eosinophil-based allergic asthma reactions in humans. 5-Oxo-ETE (or other 5-HETE family member) stimulates the growth and/or survival of human cell lines derived from cancers of the prostate, breast, lung, ovary, colon and pancreas These preclinical studies suggest that 5-oxo-ETE (or other 5-HETE family member) may contribute to the cited cancers progression in humans. 5-oxo-ETE stimulates human H295R adrenocortical cells to increase transcription of steroidogenic acute regulatory protein messenger RNA and produce aldosterone and progesterone by an apparent OXER1-dependent pathway. 5-Oxo-ETE induces an isotonic volume reduction in guinea pig intestinal crypt epithelial cells.
Public health laboratories operate as a first line of defense to protect the public against diseases and other health hazards. Day-to-day operations range from testing water and food, checking for toxins in soil, and investigating new strains of infectious diseases, such as COVID-19 or Ebola. Every US state and territory, and the District of Columbia, has a central governmental public health laboratory that performs testing and other laboratory services on behalf of the entire jurisdiction. In addition, some states have local public health laboratories ranging in size from large metropolitan laboratories with over a hundred scientists to small rural laboratories with one or two staff that support local public health.
Aminoacyl-tRNA synthetase enzymes consume ATP in the attachment tRNA to amino acids, forming aminoacyl-tRNA complexes. Aminoacyl transferase binds AMP-amino acid to tRNA. The coupling reaction proceeds in two steps: aa + ATP ⟶ aa-AMP + PPi aa-AMP + tRNA ⟶ aa-tRNA + AMP The amino acid is coupled to the penultimate nucleotide at the 3′-end of the tRNA (the A in the sequence CCA) via an ester bond (roll over in illustration). Transporting chemicals out of a cell against a gradient is often associated with ATP hydrolysis. Transport is mediated by ATP binding cassette transporters. The human genome encodes 48 ABC transporters, that are used for exporting drugs, lipids, and other compounds.
Sources: en.wikipedia.org
Helices observed in proteins can range from four to over forty residues long, but a typical helix contains about ten amino acids (about three turns). In general, short polypeptides do not exhibit much α-helical structure in solution, since the entropic cost associated with the folding of the polypeptide chain is not compensated for by a sufficient amount of stabilizing interactions. In general, the backbone hydrogen bonds of α-helices are considered slightly weaker than those found in β-sheets, and are readily attacked by the ambient water molecules. However, in more hydrophobic environments such as the plasma membrane, or in the presence of co-solvents such as trifluoroethanol (TFE), or isolated from solvent in the gas phase, oligopeptides readily adopt stable α-helical structure. Furthermore, crosslinks can be incorporated into peptides to conformationally stabilize helical folds. Crosslinks stabilize the helical state by entropically destabilizing the unfolded state and by removing enthalpically stabilized "decoy" folds that compete with the fully helical state. It has been shown that α-helices are more stable, robust to mutations and designable than β-strands in natural proteins, and also in artificially designed proteins.
The tumor-suppressor protein p53 accumulates when DNA is damaged due to a chain of biochemical factors. Part of this pathway includes alpha-interferon and beta-interferon, which induce transcription of the p53 gene, resulting in the increase of p53 protein level and enhancement of cancer cell-apoptosis. p53 prevents the cell from replicating by stopping the cell cycle at G1, or interphase, to give the cell time to repair; however, it will induce apoptosis if damage is extensive and repair efforts fail. Any disruption to the regulation of the p53 or interferon genes will result in impaired apoptosis and the possible formation of tumors.
P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Dihexa is a synthetic peptide analog related to angiotensin IV. It is studied in preclinical research for effects on neural signaling and synapse formation. It is not an approved medicine.
No. Dihexa shares a conceptual link to angiotensin IV but has different structural features. Those changes are intended to modify its behavior in biological systems.
It often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. Synonyms and CAS listings vary, so cross-checking identifiers is necessary.
The lyophilized powder is generally stored at -20 °C or lower, desiccated, and protected from light. Solutions are often aliquoted to avoid repeated freeze-thaw cycles. Specific stability data may vary by formulation and purity.