If you have been reading about synaptic plasticity and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-12-20. Numbers and descriptions here follow the published literature rather than marketing material.
Dihexa is typically supplied as a lyophilized powder for laboratory research. Lyophilization removes water and improves stability during transport and storage. The solid is commonly stored at -20 °C or lower, desiccated, and protected from light. Repeated freeze-thaw cycles and exposure to moisture can degrade peptides, so aliquoting and sealed containers are standard practice in most laboratory settings. These handling measures apply to research-grade material and do not imply clinical suitability.
Purity and identity are usually assessed with reverse-phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry. RP-HPLC separates components by hydrophobicity and can estimate peptide purity. Mass spectrometry confirms molecular mass and helps detect truncations or modifications. Some laboratories also use amino acid analysis or nuclear magnetic resonance for structural verification. A certificate of analysis from a supplier may list these results, but independent verification is often recommended for critical work.
The compound has been examined in animal models for effects on learning, memory, and synaptic connectivity. Some reports describe increased dendritic spine density and improved performance on certain behavioral tasks after administration in rodents. These findings are often cited in discussions of nootropic research peptides, but replication across independent laboratories remains limited. The absence of published phase 1 or phase 2 clinical trial data makes it difficult to assess safety, effective routes, or long-term outcomes in humans. Consequently, claims about cognitive benefits in people remain speculative.
Dihexa is not approved as a medicine in major regulatory jurisdictions. It is commonly sold as a research chemical for laboratory use, though such products may not be standardized or independently verified. Scientific literature on dihexa includes in vitro assays, rodent studies, and reviews that discuss its proposed mechanism. The distinction between peer-reviewed findings and commercial promotion is important when evaluating available information. Open questions include its precise binding interactions, pharmacokinetics, and whether animal results translate to human biology.
Dihexa is a synthetic peptide derived from angiotensin IV, a naturally occurring fragment of the renin-angiotensin system. Researchers modified the angiotensin IV structure to improve metabolic stability and central nervous system activity. It is frequently described as a hepatocyte growth factor mimetic because it can activate the c-Met receptor pathway in experimental systems. Its development reflects interest in small peptides that influence synaptic plasticity and cognitive processes. Most information comes from preclinical studies rather than controlled human trials.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical lyophilized research form. |
| Solubility | Soluble in DMSO; limited in water | Depends on purity and salt form. |
| Storage temperature | -20 °C or lower | Desiccated and protected from light. |
| Analytical method | RP-HPLC and LC-MS | Common for purity and identity. |
| Regulatory status | Research chemical in many countries | Not widely approved as a medicine. |
The proposed mechanism of dihexa centers on activation of the hepatocyte growth factor receptor, also called c-Met. Some studies suggest it acts as a mimetic of hepatocyte growth factor, promoting signaling pathways involved in synapse formation. Other work has explored interactions with angiotensin IV pathways, but the exact binding targets remain uncertain. Laboratory findings come mainly from cell cultures and animal models. Whether these mechanisms operate similarly in humans is an open question. Researchers have not established a single, universally accepted mechanism of action.
Identity and purity of dihexa samples are typically assessed with high-performance liquid chromatography and mass spectrometry. These methods can confirm molecular mass and estimate the presence of impurities. However, a certificate of analysis from a supplier is not a guarantee of independent testing. Researchers often require in-house verification before using a peptide in experiments. For solid samples, appearance, solubility, and chromatographic profile provide additional checks. Nuclear magnetic resonance may be used for structural confirmation when available.
Dihexa is commonly handled as a lyophilized powder in laboratory settings. Storage at -20 °C in a desiccated, light-protected container is typical for peptides. Repeated freeze-thaw cycles can degrade the material, so aliquoting is often recommended. Aqueous solutions may be less stable than organic stocks and should be prepared fresh when possible. Personnel should follow institutional safety procedures and avoid uncontrolled exposure. Because human effects are not well characterized, handling precautions are prudent.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
Identity checks for dihexa usually rely on mass spectrometry and chromatographic purity analysis. A lyophilized powder is the common supplied form, and it may appear as a white to off-white solid. Aqueous solubility is limited, so laboratory work often uses an organic solvent such as dimethyl sulfoxide to prepare stock solutions. Because the peptide is not a standard pharmaceutical product, exact specifications can vary between suppliers. Certificates of analysis may accompany a batch, but they are not equivalent to regulatory approval.
Dihexa is a synthetic peptide whose structure is modeled on angiotensin IV. Its chemical name often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, though vendor and publication naming can differ. The molecule combines a short amino acid sequence with a hexanoic acid group and an amide terminus. It is classed as a small research peptide rather than a conventional drug. Databases may list it under several synonyms, so matching names are important when comparing sources.
Dihexa is a synthetic peptide that has been examined in laboratory and animal research. Its design is based on angiotensin IV, a naturally occurring peptide fragment produced in the body. The short name dihexa appears in scientific papers and online discussions, while the full chemical name describes a modified peptide chain. It is not a vitamin, mineral, or plant-derived compound. Suppliers typically present it as a research chemical rather than an approved medicine.
The full name often given is N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. This name indicates a chain containing tyrosine, isoleucine, and a six-carbon amino acid derivative. Databases list a CAS Registry Number and a molecular formula for the compound. The peptide is small compared with proteins, and its structure allows it to be studied in cell cultures and animal models. Exact identity depends on the supplier's synthesis and purification process. Minor impurities can remain after synthesis.
Chemically, dihexa belongs to a broader group of angiotensin IV analogs. Researchers have modified the natural peptide to alter stability, binding, or distribution. Such changes can affect how the molecule behaves in experiments. The parent peptide angiotensin IV is involved in various physiological processes, but the modified analog is not identical to it. Public summaries sometimes blur the distinction between the natural fragment and the synthetic research compound. This distinction matters when interpreting study results.
Identity and purity are usually assessed with reverse-phase high-performance liquid chromatography and mass spectrometry. These methods can separate related impurities and confirm molecular mass, but they do not by themselves establish biological activity. Certificate of analysis documents may report purity as a percentage by area, yet the exact meaning can vary between laboratories. Independent testing can check for residual solvents, counterions, or microbial contamination when relevant. For research use, matching analytical records to a specific lot helps trace experimental variability.
Dihexa occupies an uncertain regulatory space in many countries. It is not generally listed as an approved therapeutic, and some jurisdictions may treat it as a research chemical, a compounded substance, or an unapproved new drug depending on claims and distribution. Importation can be restricted, and suppliers may require documentation that the material is for laboratory research only. Quality and labeling vary, so buyers should request analytical data, verify lot numbers, and understand local rules. These factors make sourcing and compliance part of the practical context around dihexa.
Lyophilized dihexa is typically stored as a dry powder at or below minus twenty degrees Celsius. Cooler temperatures slow degradation, and desiccant protection limits moisture uptake. Repeated temperature cycling can accelerate breakdown, so aliquoting before storage is common in laboratory practice. Solutions are generally less stable than dry powder and are often kept cold, protected from light, and used within a defined period. Specific stability data for dihexa are limited, and handling recommendations often follow general peptide guidelines rather than compound-specific studies.
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The Wnt signaling pathway can be divided in canonical and non-canonical. The canonical signaling involves binding of Wnt to Frizzled and LRP5 co-receptor, leading to GSK3 phosphorylation and inhibition of β-catenin degradation, resulting in its accumulation and translocation to the nucleus, where it acts as a transcription factor. The non-canonical Wnt signaling can be divided in planar cell polarity (PCP) pathway and Wnt/calcium pathway. It is characterized by binding of Wnt to Frizzled and activation of G proteins and to an increase of intracellular levels of calcium through mechanisms involving PKC 50. The Wnt signaling pathway plays a significant role in osteoblastogenesis and bone formation, inducing the differentiation of mesenquimal pluripotent cells in osteoblasts and inhibiting the RANKL/RANK pathway and osteoclastogenesis.
Distal membrane-arm assembly complex protein 1 is a protein that in humans is encoded by the DMAC1 gene (previously TMEM261). TMEM261 is also known as C9ORF123 and DMAC1, Chromosome 9 Open Reading Frame 123 and Transmembrane Protein C9orf123 and Distal membrane-arm assembly complex protein 1. TMEM261 is located at 9p24.1, its length is 91,891 base pairs (bp) on the reverse strand. Its neighbouring gene is PTPRD located at 9p23-p24.3 also on the reverse strand and encodes protein tyrosine phosphatase receptor type delta. TMEM261 has 2 exons and 1 intron, and 6 primary transcript variants; the largest mRNA transcript variant consisting of 742bp with a protein 129 amino acids (aa) in length and 13,500 daltons (Da) in size, and the smallest coding transcript variant being 381bp with a protein 69aa long and 6,100 Da in size. TMEM261 is a protein consisting out of 112 amino acids, with a molecular weight of 11.8 kDa. The isoelectric point is predicted to be 10.2, whilst its posttranslational modification value is 9.9.
Sources: en.wikipedia.org
By continuously scanning a surface, such as tissue section, nano-DESI can be used for imaging. By carefully choosing the experimental conditions, such as the nano-DESI solvent, additives, and the ionization mode (positive or negative) we can map the distribution of a wide variety of complex molecules on different surfaces. A few examples to mention are proteins, lipids, small metabolites, drugs or even the distribution of endogenous alkali metals. Nano-DESI has been applied for localized analysis of complex molecules and imaging of tissue sections, microbial communities and environmental samples. By decreasing the inner diameter of the primary and secondary capillaries, spatial resolution can be decreased to 20x20 μm or even smaller facilitating the analysis of individual cells. This way even various proteoforms can be measured in single cells as well as global and spatial metabolomics.
The 1993 film Jurassic Park (based on the 1990 Michael Crichton novel of the same name) features dinosaurs that were genetically altered so that they could not produce the amino acid lysine. This was known as the "lysine contingency" and was supposed to prevent the cloned dinosaurs from surviving outside the park, forcing them to be dependent on lysine supplements provided by the park's veterinary staff. In reality, no animals are capable of producing lysine (it is an essential amino acid). Autotroph Bradytroph "Regulation of endosomal clathrin and retromer-mediated endosome to Golgi retrograde transport by the J-domain protein RME-8" - The EMBO Journal "Pleiotropic effects of purine auxotrophy inRhizobium meliloti on cell surface molecules" - Springerlink "Auxotrophy and Organic Compounds in the Nutrition of Marine Phytoplankton"
Diamphotoxin is a toxin produced by larvae and pupae of the beetle genus Diamphidia. Diamphotoxin is a hemolytic, cardiotoxic, and highly labile single-chain polypeptide bound to a protein that protects it from deactivation. Diamphotoxin increases the permeability of cell membranes of red blood cells. Although this does not affect the normal flow of ions between cells, it allows all small ions to pass through cell membranes easily, which fatally disrupts the cells' ion levels. Although diamphotoxin has no neurotoxic effect, its hemolytic effect is lethal, and may reduce hemoglobin levels by as much as 75%. The San people of Southern Africa use diamphotoxin as an arrow poison for hunting game. The toxin paralyses muscles gradually. Large mammals hunted in this way die slowly from a small injection of the poison. Several leaf beetles species of genus Leptinotarsa produce a similar toxin, leptinotarsin. Palytoxin Arrow poison
Sources: en.wikipedia.org
Commercial availability varies by country. Approved systems in various countries, described further below, include MiniMed 670G or 780G, Tandem's Control-IQ, Omnipod 5, CamAPS FX, and Diabeloop DBLG1. In September 2016, the FDA approved the Medtronic MiniMed 670G, which was the first approved hybrid closed loop system. The device automatically adjusts a patient's basal insulin delivery. It is made up of a continuous glucose monitor, an insulin pump, and a glucose meter for calibration. It automatically functions to modify the level of insulin delivery based on the detection of blood glucose levels by continuous monitor. It does this by sending the blood glucose data through an algorithm that analyzes and makes the subsequent adjustments. The system has two modes. Manual mode lets the user choose the rate at which basal insulin is delivered. Auto mode regulates basal insulin levels from the CGM readings every five minutes.
The above descriptions ignore the effects of Gβγ–signalling, which can also be important, in particular in the case of activated Gαi/o-coupled GPCRs. The primary effectors of Gβγ are various ion channels, such as G-protein-regulated inwardly rectifying K+ channels (GIRKs), P/Q- and N-type voltage-gated Ca2+ channels, as well as some isoforms of AC and PLC, along with some phosphoinositide-3-kinase (PI3K) isoforms.
From 2002 to 2004, Pinhasov carried out postdoctoral research at Johnson & Johnson Pharmaceutical Research and Development (Spring House, Pennsylvania, United States), where under the guidance of Dr. Douglas Brenneman he was engaged in the development of drugs for the treatment of neurodegenerative diseases. In 2005, Pinhasov joined the Department of Molecular Biology at Ariel University (formerly the College of Judea and Samaria) as an assistant professor. He was Head of the department from 2008 to 2014. In 2014, Pinhasov was appointed Vice-President and Dean of Research & Development at Ariel University, holding this position until 2020. In 2020 the Senate of Ariel University elected Professor Pinhasov as the Rector of Ariel University, succeeding Professor Michael Zinigrad, who held this office for 12 years. In September 2023, in recognition of his contribution to academic ties between Israel and Kazakhstan, the Senate of Astana Medical University (AMU) awarded Prof. Albert Pinhasov the title of honorary professor.
Tbr1 is a protein, called a transcription factor, that binds to DNA and regulates the transcription of genes into mRNA. It is expressed in postmitotic projection neurons and is critical for normal brain development. Tbr1 has been shown to be expressed in the developing olfactory bulb. Tbr1 has also been observed in the developing cerebral cortex. Tbr1 has several functions. These include involvement in the developmental process, brain development, neuronal differentiation, axon guidance, and regulation of neurons in the developing neocortex.
Sources: en.wikipedia.org
The lyophilized powder is generally stored at -20 °C or lower, desiccated, and protected from light. Solutions are often aliquoted to avoid repeated freeze-thaw cycles. Specific stability data may vary by formulation and purity.
Mass spectrometry is commonly used to confirm molecular mass, while RP-HPLC estimates purity. These methods can be combined with amino acid analysis or NMR for further structural confirmation. A certificate of analysis alone does not guarantee independent verification.
Legality depends on the country and the intended use. In many places it is not approved as a drug and may be regulated as a research chemical. Buyers should check local laws and institutional policies before obtaining it.
Dihexa is a synthetic peptide derived from angiotensin IV and studied for effects on synaptic plasticity. It is often described as a hepatocyte growth factor mimetic. It is not an approved medication.