This is a working overview of Dihexa, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-12-09 and is reviewed periodically as new material appears.
Development of dihexa has been linked to academic research on synaptogenesis, the formation of new synapses. Preclinical studies in rodents have examined its effects on learning and memory tasks. These studies are often cited in discussions about cognitive enhancement, but they do not establish safety or efficacy in humans. The compound's patent and commercial history is limited, and it is not widely available through pharmaceutical channels. Most information comes from animal models and in vitro experiments. Researchers continue to explore its basic biology rather than clinical applications.
Dihexa is not approved for human use in the United States or the European Union. It is commonly sold as a research chemical, a category that may not require the same regulatory review as medicines. Buyers should note that product labels may lack independent verification of identity or purity. The legal status can vary by country, and importation may be restricted. Reliable information about sourcing and quality is often scarce. Scientific publications typically use synthesized material from laboratories rather than commercial consumer products.
Dihexa is a synthetic peptide studied in laboratory research. It is often described as an angiotensin IV analog or a hepatocyte growth factor mimetic. The compound emerged from investigations into angiotensin IV and its effects on neural pathways. It is not an approved medication, and controlled human trials are lacking. In literature and online forums, it is discussed mainly as a research chemical. Its chemical name appears as N-hexanoic-Tyr-Ile-(6-aminohexanoic amide) in some sources.
The proposed mechanism of dihexa centers on activation of the hepatocyte growth factor receptor, also called c-Met. Some studies suggest it acts as a mimetic of hepatocyte growth factor, promoting signaling pathways involved in synapse formation. Other work has explored interactions with angiotensin IV pathways, but the exact binding targets remain uncertain. Laboratory findings come mainly from cell cultures and animal models. Whether these mechanisms operate similarly in humans is an open question. Researchers have not established a single, universally accepted mechanism of action.
Identity and purity of dihexa samples are typically assessed with high-performance liquid chromatography and mass spectrometry. These methods can confirm molecular mass and estimate the presence of impurities. However, a certificate of analysis from a supplier is not a guarantee of independent testing. Researchers often require in-house verification before using a peptide in experiments. For solid samples, appearance, solubility, and chromatographic profile provide additional checks. Nuclear magnetic resonance may be used for structural confirmation when available.
Dihexa is commonly handled as a lyophilized powder in laboratory settings. Storage at -20 °C in a desiccated, light-protected container is typical for peptides. Repeated freeze-thaw cycles can degrade the material, so aliquoting is often recommended. Aqueous solutions may be less stable than organic stocks and should be prepared fresh when possible. Personnel should follow institutional safety procedures and avoid uncontrolled exposure. Because human effects are not well characterized, handling precautions are prudent.
| Property | Value | Notes |
|---|---|---|
| CAS Registry Number | 1401708-83-5 | Identifier used in chemical databases. |
| Common synonyms | P21; N-hexanoic-Tyr-Ile-(6-aminohexanoic amide) | Names vary by supplier and publication. |
| Physical form | White to off-white powder | Lyophilized solid typical of peptides. |
| Solubility | Soluble in DMSO; limited in water | Aqueous preparation may need a co-solvent. |
| Storage | -20 °C, desiccated, protected from light | Reduce freeze-thaw cycles to maintain stability. |
Dihexa is a synthetic peptidomimetic derived from angiotensin IV, a naturally occurring peptide fragment. It was created as a research compound to explore central nervous system signaling rather than as an approved therapeutic. Early work described it as a small, orally available molecule in rodent studies. Its structure combines tyrosine, isoleucine, and aminohexanoic acid components with a hexanoic acid cap. The compound is commonly referred to by the research code PNB-0408.
Development of dihexa followed from studies on angiotensin IV analogs and their effects on learning and memory. Researchers sought compounds with improved metabolic stability and brain penetration compared with natural peptides. In preclinical reports, dihexa was associated with changes in synaptic connectivity and performance on spatial tasks. These findings generated interest in its potential as a cognitive research tool. The work remains largely preclinical, and independent replication has been limited.
Regulatory and commercial contexts differ from clinical medicine. Dihexa is not approved as a drug by major agencies, and no published human trials establish its safety or efficacy. It is often sold as a research chemical labeled for laboratory use only. Suppliers may provide certificates of analysis, but purity and identity depend on the specific batch. Legal status varies by country and may treat such compounds as unapproved substances for human consumption.
The proposed mechanism for dihexa centers on hepatocyte growth factor, or HGF, and its receptor c-Met. HGF signaling is involved in cell growth, survival, and synapse formation. Dihexa has been described as an HGF mimetic or modulator in preclinical literature. Whether it binds c-Met directly, increases HGF availability, or acts through another route remains uncertain. This mechanistic uncertainty is a recurring theme in reviews of the compound, and no single molecular model has been confirmed across independent laboratories.
Research on dihexa has primarily used rodent models and cultured cells. Common endpoints include dendritic spine density, synaptic protein expression, and performance on maze or avoidance tasks. Some studies report improvements in cognitive measures after scopolamine-induced deficits or in aged animals. These findings are interesting but come from a small body of work, and independent laboratories have not consistently replicated all reported effects. Larger, preregistered studies would help clarify which results are robust.
Dihexa is a synthetic peptide-like compound studied in preclinical research for its reported effects on synaptic growth and cognitive measures in animal models. It is often described as an analog of angiotensin IV, a naturally occurring peptide fragment. The compound has not been approved as a medicine in any major jurisdiction. Most public information comes from laboratory studies, patents, and online vendor listings rather than from large clinical trials. Its scientific status therefore differs from that of an established pharmaceutical.
Research interest in dihexa centers on its ability to promote synapse formation in cultured neurons and in some rodent experiments. These findings have been interpreted as a possible mechanism for learning and memory effects, but the evidence remains preliminary. Independent replication is limited, and study designs vary widely in species, duration, and outcome measures. Human data are scarce, so claims about cognitive enhancement in people are not supported by robust clinical evidence. The gap between laboratory signals and proven clinical benefit is substantial.
== Toxicity == The toxicity of djenkolic acid in humans arises from its poor solubility under acidic conditions after consumption of the djenkol bean. The amino acid precipitates into crystals which cause mechanical irritation of the renal tubules and urinary tract, resulting in symptoms such as abdominal discomfort, loin pains, severe colic, nausea, vomiting, dysuria, gross hematuria, and oliguria, occurring 2 to 6 hours after the beans were ingested. Urine analysis of patients reveals erythrocytes, epithelial cells, protein, and the needle-like crystals of djenkolic acid. Urolithiasis can also happen, with djenkolic acid as the nucleus. In young children, it has also been reported to produce painful swelling of the genitalia. Treatment for this toxicity requires hydration to increase urine flow and alkalinization of urine by sodium bicarbonate. Furthermore, this poisoning can be prevented when consuming djenkol beans by boiling them beforehand, since djenkolic acid is removed from the beans.
==== Magnetic drug delivery ==== Magnetic nanochains are a class of new magnetoresponsive and superparamagnetic nanostructures with highly anisotropic shapes (chain-like) which can be manipulated using magnetic field and magnetic field gradient. The magnetic nanochains possess attractive properties which are significant added value for many potential uses including magneto-mechanical actuation-associated nanomedicines in low and super-low frequency alternating magnetic field and magnetic drug delivery. Cell imaging Nanoparticles have good biological labeling and sensing because of brightness and photostability; thus, certain self-assembled nanoparticles can be used as imaging contrast in various systems. Combined with polymer cross-linkers, the fluorescence intensity can also be enhanced. Surface modification with functional groups, can also lead to selective biological labeling. Self-assembled nanoparticles are also more biocompatible compared to standard drug delivery systems.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
Let us imagine how many people would die if war breaks out. There are 2.7 billion people in the world, and a third could be lost. If it is a little higher it could be half ... I say that if the worst came to the worst and one-half dies, there will still be one-half left, but imperialism would be razed to the ground and the whole world would become socialist. After a few years there would be 2.7 billion people again.
=== Birth defects === The drug thalidomide binds to cereblon and changes which substrates can be degraded by it, which leads to an antiproliferative effect on myeloma cells and possibly the teratogenic effect on fetal development. Thalidomide was used as a treatment for morning sickness from 1957 until 1961 but was withdrawn from the market after it was discovered that it caused birth defects. It is estimated that 10,000 to 20,000 children were affected. However, the idea that cereblon modulation is responsible for the teratogenic activity of thalidomide in the chick and zebrafish was cast into doubt due to a 2013 report that pomalidomide (a more potent thalidomide analogue) does not cause teratogenic effects in these same model systems even though it binds with cereblon more strongly than thalidomide.
Nitriles are susceptible to hydrogenation over diverse metal catalysts. The reaction can afford either the primary amine (RCH2NH2) or the tertiary amine ((RCH2)3N), depending on conditions. In conventional organic reductions, nitrile is reduced by treatment with lithium aluminium hydride to the amine. Reduction to the imine followed by hydrolysis to the aldehyde takes place in the Stephen aldehyde synthesis, which uses stannous chloride in acid.
Sources: en.wikipedia.org
submetacentric (of a linear chromosome or chromosome fragment) Having a centromere positioned close to but not exactly in the middle of the chromosome, resulting in chromatid arms of slightly different lengths. Compare metacentric.
=== Biomedical applications === Because of their relatively large surface area, CNTs are capable of interacting with a wide variety of therapeutic and diagnostic agents (drugs, genes, vaccines, antibodies, biosensors, etc.). This can be utilized to assist in drug delivery directly into cells. In addition, CNTs have recently been used as reinforcements in implants and scaffolds due to their suitable reaction area, high elastic modulus, and load transfer capability.
Glutamic acid, being a constituent of protein, is present in foods that contain protein, but it can only be tasted when it is present in an unbound form. Significant amounts of free glutamic acid are present in a wide variety of foods, including cheeses and soy sauce, and glutamic acid is responsible for umami, one of the five basic tastes of the human sense of taste. Glutamic acid often is used as a food additive and flavor enhancer in the form of its sodium salt, known as monosodium glutamate (MSG).
Sources: en.wikipedia.org
Dihexa is a synthetic peptide investigated in preclinical research. It is often classified as an angiotensin IV analog or an HGF mimetic. It is not an approved medicine.
No. Regulatory agencies have not approved dihexa for human use. It is sold as a research chemical in some markets, and human safety and efficacy data are lacking.
Laboratory studies have examined its effects on synapse formation and cognitive tasks in animals. These are early-stage findings. They do not prove benefits or safety in people.
Liquid chromatography–mass spectrometry is commonly used. It provides molecular mass and purity information. Other methods may include HPLC with ultraviolet detection.