If you have been reading about research chemical and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-06-13. Where a claim depends on a specific study, the study is described rather than over-claimed.
Dihexa is typically supplied as a lyophilized powder for laboratory research. Lyophilization removes water and improves stability during transport and storage. The solid is commonly stored at -20 °C or lower, desiccated, and protected from light. Repeated freeze-thaw cycles and exposure to moisture can degrade peptides, so aliquoting and sealed containers are standard practice in most laboratory settings. These handling measures apply to research-grade material and do not imply clinical suitability.
Purity and identity are usually assessed with reverse-phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry. RP-HPLC separates components by hydrophobicity and can estimate peptide purity. Mass spectrometry confirms molecular mass and helps detect truncations or modifications. Some laboratories also use amino acid analysis or nuclear magnetic resonance for structural verification. A certificate of analysis from a supplier may list these results, but independent verification is often recommended for critical work.
Dihexa is a synthetic compound studied in laboratory and animal models for effects on synaptic connectivity and cognitive performance. It is often described as a peptide analog because its structure incorporates amino acid residues linked to a hexanoic acid group. The molecule is not a naturally occurring human hormone or neurotransmitter. Its name appears in research literature and online discussions, but it has not been approved as a medicine by major regulatory agencies. Most information comes from preclinical experiments rather than controlled human trials.
The compound originated from work on angiotensin IV, a peptide fragment of the renin-angiotensin system. Researchers modified angiotensin IV-related structures to produce molecules with altered stability and activity. Dihexa emerged from that effort and was reported to promote dendritic spine growth in cultured neurons. Some studies link its effects to hepatocyte growth factor signaling and the c-Met receptor, while other work points to insulin-regulated aminopeptidase. The precise primary target remains a subject of investigation, and findings may depend on cell type, assay conditions, and species.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical lyophilized research form. |
| Solubility | Soluble in DMSO; limited in water | Depends on purity and salt form. |
| Storage temperature | -20 °C or lower | Desiccated and protected from light. |
| Analytical method | RP-HPLC and LC-MS | Common for purity and identity. |
| Regulatory status | Research chemical in many countries | Not widely approved as a medicine. |
Lyophilized dihexa is typically stored as a dry powder at or below minus twenty degrees Celsius. Cooler temperatures slow degradation, and desiccant protection limits moisture uptake. Repeated temperature cycling can accelerate breakdown, so aliquoting before storage is common in laboratory practice. Solutions are generally less stable than dry powder and are often kept cold, protected from light, and used within a defined period. Specific stability data for dihexa are limited, and handling recommendations often follow general peptide guidelines rather than compound-specific studies.
Identity and purity are usually assessed with reverse-phase high-performance liquid chromatography and mass spectrometry. These methods can separate related impurities and confirm molecular mass, but they do not by themselves establish biological activity. Certificate of analysis documents may report purity as a percentage by area, yet the exact meaning can vary between laboratories. Independent testing can check for residual solvents, counterions, or microbial contamination when relevant. For research use, matching analytical records to a specific lot helps trace experimental variability.
Development of dihexa has been linked to academic research on synaptogenesis, the formation of new synapses. Preclinical studies in rodents have examined its effects on learning and memory tasks. These studies are often cited in discussions about cognitive enhancement, but they do not establish safety or efficacy in humans. The compound's patent and commercial history is limited, and it is not widely available through pharmaceutical channels. Most information comes from animal models and in vitro experiments. Researchers continue to explore its basic biology rather than clinical applications.
Dihexa is not approved for human use in the United States or the European Union. It is commonly sold as a research chemical, a category that may not require the same regulatory review as medicines. Buyers should note that product labels may lack independent verification of identity or purity. The legal status can vary by country, and importation may be restricted. Reliable information about sourcing and quality is often scarce. Scientific publications typically use synthesized material from laboratories rather than commercial consumer products.
Overall, automated synthesis has improved the efficiency for the parallel synthesis and combinatorial methods of polymers. These techniques aim to design new materials, in addition to studying the relationships of their structure and properties. However, while screening for polymers enables this investigation, it becomes increasingly demanding for researchers to create the libraries for these synthetic compositions. In addition, preparation requires a large number of repetitive reactions to be completed, leading to an immense burden of planning and labor. Using automated synthesis, this process can be refined, increasing the efficiency of the reaction and removing the impact of human error.
Clostridioides difficile has a highly diverse epigenome, with 17 high-quality methylation motifs reported so far, the majority pertaining to the 6mA type. Methylation at one of these motifs - CAAAAA, was shown to impact sporulation, a key step in C. difficile disease transmission, as well as cell length, biofilm formation, and host colonization. At least eight mainly temperate bacteriophages have been isolated from C. difficile, ranging in genome size from about 30 to about 60 kbp. Both environmentally and clinically derived C. difficile strains carry a diverse and prevalent set of prophages. Canada Pathogen Safety Data Sheets: Infectious Substances – Clostridium difficile, Public Health Agency, Canada, September 10, 2014. Type strain of Clostridium difficile, BacDive—the Bacterial Diversity Metadatabase
The Swiss company GlycArt Biotechnology developed a system using CHO cells, where the cells were engineered to overexpress an enzyme called GnTIII. The effect of this overexpression is to block the formation of fucosylated oligosaccharides on the expressed antibodies. This technology was first reported in 1999 and was the basis of GlycArt Biotechnology. Roche acquired GlycArt in 2005 in order to acquire technology to afucosylate antibodies. GlycArt Biotechnology had been founded in 2000 as a spin-out company of the Swiss Federal Institute of Technology in Zurich. The first commercial product from the GlycArt acquisition was obinutuzumab, which as Gazyva gained FDA approval in November 2013 for the treatment of chronic lymphocytic leukemia. Kyowa Hakko Kirin's "Potelligent" platform uses a CHO cell line in which FUT8 has been knocked out, and which produces antibodies with little to no fucose in the Fc region. The company gained marketing approval in Japan in April 2012 for a monoclonal antibody drug called mogamulizumab which was developed using the platform. The Company's technology was first reported in 2004.
Sources: en.wikipedia.org
Carnitine is an essential cofactor for mitochondrial transport of long‑chain fatty acids (a major lipid class) into the matrix for β‑oxidation. gamma-aminobutyric acid is a neurotransmitter. 5-HTP (5-hydroxytryptophan) is used for experimental treatment of depression. L-DOPA (L-dihydroxyphenylalanine) for Parkinson's treatment, Eflornithine inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Canavanine, an analogue of arginine found in many legumes is an antifeedant, protecting the plant from predators. Mimosine found in some legumes, is another possible antifeedant. This compound is an analogue of tyrosine and can poison animals that graze on these plants. However, not all of the functions of other abundant nonstandard amino acids are known.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
From the 17th century, and before modern developments in organic chemistry nomenclature, acetone was given many different names. They included "spirit of Saturn", which was given when it was thought to be a compound of lead and, later, "pyro-acetic spirit" and "pyro-acetic ester". Prior to the name "acetone" being coined by French chemists, it was named "mesit" (from the Greek μεσίτης, meaning mediator) by Carl Reichenbach, who also said that methyl alcohol consisted of mesit and ethyl alcohol. Names derived from mesit include mesitylene and mesityl oxide which were first synthesised from acetone. In 1839, the name "acetone" began to be used, because it was obtained from acetic acid. Unlike many compounds with the acet- prefix which have a 2-carbon chain, acetone has a 3-carbon chain. That has caused confusion because there can not be a ketone with 2 carbons. The prefix refers to acetone's relation to vinegar (acetum in Latin, also the source of the words "acid" and "acetic"), rather than its chemical structure.
Sources: en.wikipedia.org
Aaron R. Wheeler is a Canadian chemist who is a professor of chemistry and biomedical engineering at the University of Toronto since 2005 with cross-appointment at Institute of Biomedical Engineering and Terrence Donnelly Centre for Cellular and Biomolecular Research. His academic laboratory is located at Lash Miller Chemical Laboratories and Terrence Donnelly Centre for Cellular and Biomolecular Research at the University of Toronto. In 2005, Wheeler was appointed as assistant professor and Tier II Canada Research Chair then promoted to associate professor in 2010, full professor in 2013, and in 2018 he became the Tier I Canada Research Chair in Microfluidic Bioanalysis. Wheeler did his undergraduate studies at Furman University in Greenville, SC then he joined Stanford University from 1997 to 2003 to obtain his Ph.D. in chemistry under supervision of Richard Zare . Following graduation, he took a two-year NIH postdoctoral fellowship at UCLA till 2005.
Whey protein contains high levels of all the essential amino acids and branched-chain amino acids. It also has the highest content of the amino acid cysteine, which aids in the biosynthesis of glutathione. For bodybuilders, whey protein provides amino acids used to aid in muscle recovery. Whey protein is derived from the process of making cheese from milk. There are three types of whey protein: whey concentrate, whey isolate, and whey hydrolysate. Whey concentrate is 29–89% protein by weight whereas whey isolate is 90%+ protein by weight. Whey hydrolysate is enzymatically predigested and therefore has the highest rate of digestion of all protein types. Casein protein (or milk protein) has glutamine, and casomorphin. Some nutritionists have suggested that higher calcium excretion may be due to a corresponding increase in protein-induced calcium absorption in the intestines. Some bodybuilders believe that amino acid supplements may benefit muscle development, but consumption of such supplements is unnecessary in a diet that already includes adequate protein intake.
"Biosafety in Microbiological and Biomedical Laboratories", official CDC guide. "Prevention of Biological Hazards", EU-OSHA "Symbol Making", an account of the development of the symbol in 1966. "BioSeal Systems", Biosafety level 4 containment. Biohazard Remediation Compliance Overview "Example of Reclassified Biohazard to Level 4", article from The Lancet concerning the reclassification of Ebola after observation. "Biological hazards related to working alone safety", an article focusing on working alone safety when dealing with biological hazards
A sequence space is usually laid out as a grid. For protein sequence spaces, each residue in the protein is represented by a dimension with 20 possible positions along that axis corresponding to the possible amino acids. Hence there are 400 possible dipeptides arranged in a 20x20 space but that expands to 10130 for even a small protein of 100 amino acids arranged in a space with 100 dimensions. Although such overwhelming multidimensionality cannot be visualised or represented diagrammatically, it provides a useful abstract model to think about the range of proteins and evolution from one sequence to another. These highly multidimensional spaces can be compressed to 2 or 3 dimensions using principal component analysis. A fitness landscape is simply a sequence space with an extra vertical axis of fitness added for each sequence.
Sources: en.wikipedia.org
The lyophilized powder is generally stored at -20 °C or lower, desiccated, and protected from light. Solutions are often aliquoted to avoid repeated freeze-thaw cycles. Specific stability data may vary by formulation and purity.
Mass spectrometry is commonly used to confirm molecular mass, while RP-HPLC estimates purity. These methods can be combined with amino acid analysis or NMR for further structural confirmation. A certificate of analysis alone does not guarantee independent verification.
Legality depends on the country and the intended use. In many places it is not approved as a drug and may be regulated as a research chemical. Buyers should check local laws and institutional policies before obtaining it.
Dihexa is a synthetic peptide-like compound studied primarily in preclinical models. It is often classified as an angiotensin IV analog and has been investigated for effects on neuronal connectivity. It is not an approved drug or dietary supplement.